Experiment :
quiet-image

Structure Complexes Generated

10

Combined Score

-162.454 ±6.521

Interface RMSD

1.02 ±0.595

DockQ Score

0.815 ±0.109

Docking Performance Distribution
Heavy Chain Sequence
QAELLESGAVVKAPGSSVTVTAKISGYGFSSDGYLISWDRQAPGRGLEWVGGTMPTTGQGMRRNPKIQGQVTLTADPSTSTTYLQLSKLTSEDSAAYYVARLSTETLVGRVPQWGLDYFDTAGAGTTVTVSL
Light Chain Sequence
DIQITQSPSSRSAGVGDRASITCRTSQSLPECNSTTYHHWYYVEKPGKAPRLRIYAGSSRGTGAPDRFSGAGSATDFTLTISSTPTLLEPEDFATFICQQSHDTYPHYQLQTFFPGTKVEIKGIP
Best-Scoring Complex: mdscoring_8.pdb

3Dmol.js failed to load for some reason. Please check your browser console for error messages.

Individual Performance
model md5 caprieval_rank score irmsd fnat lrmsd ilrmsd dockq cluster-id cluster-ranking model-cluster-ranking air angles bonds bsa cdih coup dani desolv dihe elec improper rdcs rg total vdw vean xpcs
Loading ITables v2.3.0 from the internet... (need help?)
FrankIES : Scalable, AI-Based Antibody Design Against 2025 H5N1 Avian Influenza Isolates

FrankIES (Frankie Immune Engineering Suite) is a computational pipeline for antibody engineering that integrates multiple advanced tools:

  • Diffusion: EvoDiff v1.1.0 (Docker container: cford38/evodiff:v1.1.0)
  • Folding: ESM
  • Docking: HADDOCK3 (Docker container: cford38/haddock:3)

Host System: Ubuntu 22.04 with NVIDIA 560 drivers and CUDA 12.6

The pipeline automates the complex process of antibody design, folding, docking, and evaluation, providing comprehensive results visualization through this interactive report.